PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G31620.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 27842.9 Da    PI: 9.2831
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G31620.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.54.7e-301059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     rienk+ rqvtf+kRrng+lKKA+ELS+LCdaeva+iifs++gklyey++
  OMERI03G31620.4 10 RIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALIIFSTKGKLYEYAT 59
                     9***********************************************86 PP

2K-box103.42.8e-3479171597
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                         s+e+ ++ ++++e++kLk+++e++q+ q+hl+GedLesL+lkeLqqLeqqLe+slk+iRs+K++l+le+i+elq+kek+lqeenk  +k+
  OMERI03G31620.4  79 VLISAESDTQGNWCHEYRKLKAKVETIQKCQKHLMGEDLESLNLKELQQLEQQLENSLKHIRSRKSQLMLESINELQRKEKSLQEENKLVEKQ 171
                      55567788899****************************************************************************987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.819161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-33286IPR002100Transcription factor, MADS-box
CDDcd002653.44E-41276No hitNo description
PRINTSPR004041.6E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-2984170IPR002487Transcription factor, K-box
PROSITE profilePS5129717.36888179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRGKVVLQR IENKISRQVT FAKRRNGLLK KAYELSILCD AEVALIIFST KGKLYEYATD  60
SCMDKILERY ERYSYAEKVL ISAESDTQGN WCHEYRKLKA KVETIQKCQK HLMGEDLESL  120
NLKELQQLEQ QLENSLKHIR SRKSQLMLES INELQRKEKS LQEENKLVEK QKVQKQQVQW  180
DQTQPQTSSS SSSFMMREAL PTTNISNYPA AAGERIEDVA AGQPQHVRIG LPPWMLSHIN  240
G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-21174173Myocyte-specific enhancer factor 2B
1tqe_R2e-21174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-21174173Myocyte-specific enhancer factor 2B
1tqe_P2e-21174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3324780.0AY332478.1 Oryza sativa (japonica cultivar-group) MADS box protein (AGL10) mRNA, complete cds.
GenBankFJ7509350.0FJ750935.1 Oryza sativa clone KCS096F11 MADS-box transcription factor 14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631034.11e-149PREDICTED: MADS-box transcription factor 14 isoform X2
SwissprotQ10CQ11e-151MAD14_ORYSJ; MADS-box transcription factor 14
TrEMBLA0A0E0D6X91e-179A0A0E0D6X9_9ORYZ; Uncharacterized protein
STRINGBGIOSGA009798-PA1e-149(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-68MIKC_MADS family protein